생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
6D6, monoclonal
형태
buffered aqueous solution
종 반응성
rat, mouse, human
기술
indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... USP14(9097)
일반 설명
Ubiquitin specific peptidase 14 (USP14) is a 494 amino acid protein containing a 45kDa catalytic domain at its amino-terminus. Its ubiquitin-like (Ubl) domain associates with 19S regulatory particle (RP) 26S proteasome. This binding activates the deubiquitinating activity of the protein. USP14 is part of the ubiquitin-specific processing (UBP) family of proteases.
면역원
USP14 (NP_005142, 395 a.a. ~ 494 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Sequence
PQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
생화학적/생리학적 작용
Ubiquitin specific peptidase 14 (USP14) releases ubiquitin from the proteasome-targeted ubiquitinated proteins resulting in regeneration of ubiquitin at the proteasome. It is involved in the degradation of chemokine receptor CXCR4. Under endoplasmic reticulum (ER) stress, USp14 binds to ER stress receptor, which is involved in unfolded protein response (UPR), a mechanism to control the accumulation of unfolded proteins within the ER lumen. Its overexpression leads to ER-associated degradation (ERAD) pathway inhibition.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Structure and mechanisms of the proteasome-associated deubiquitinating enzyme USP14
The Embo Journal (2005)
Deubiquitination of CXCR4 by USP14 is critical for both CXCL12-induced CXCR4 degradation and chemotaxis but not ERK activation
Marjelo A Mines
The Journal of Biological Chemistry (2008)
USP14 inhibits ER-associated degradation via interaction with IRE1alpha
Atsushi Nagai
Biochemical and Biophysical Research Communications (2009)
Zhanyu Ding et al.
Molecular cell, 73(6), 1150-1161 (2019-02-23)
The 26S proteasome is the ATP-dependent protease responsible for regulating the proteome of eukaryotic cells through degradation of mainly ubiquitin-tagged substrates. In order to understand how proteasome responds to ubiquitin signal, we resolved an ensemble of cryo-EM structures of proteasome
Jayashree Chadchankar et al.
PloS one, 14(11), e0225145-e0225145 (2019-11-09)
USP14 is a cysteine protease deubiquitinase associated with the proteasome and plays important catalytic and allosteric roles in proteasomal degradation. USP14 inhibition has been considered a therapeutic strategy for accelerating degradation of aggregation-prone proteins in neurodegenerative diseases and for inhibiting
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.