WH0008521M3

Monoclonal Anti-GCM1 antibody produced in mouse

clone 3G7, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-GCMA, Anti-glial cells missing homolog 1 (Drosophila), Anti-hGCMa
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3G7, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• GenBank 수납 번호: NM_003643
• UniProt 수납 번호: Q9NP62
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GCM1(8521)

설명

일반 설명

The gene GCM1 (glial cells missing homolog 1) is mapped to human chromosome 6p12. It belongs to the glial cells missing (GCM) family. GCM1 is present in villous cytotrophoblast cells, the syncytiotrophoblast layer and extravillous trophoblast cells.

면역원

GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*

생화학적/생리학적 작용

GCM1 (glial cells missing homolog 1) is a transcription factor that is specific for placenta. It plays an important role in trophoblast cell fusion and invasion by enhancing the expression of syncytin-1 and syncytin-2 fusogenic proteins and high-temperature requirement protein A4 (HtrA4), a serine protease. Disruption in the activity of this gene can result in defective placental development, thereby leading to embryonic death.

특징 및 장점

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)