생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3E9, monoclonal
형태
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MFGE8(4240)
일반 설명
Milk fat globule epidermal growth factor 8 (Mfge8) is a peripheral membrane soluble glycoprotein. It is liberated by several cells like macrophages. This protein is also termed as a phagocytosis “eat me” signal. It is predominantly expressed in lactating mammary glands.MFG-E8 has two-repeated EGF-like domains, a mucin-like domain, two-repeated discoidin-like domains (C-domains) and an integrin-binding motif (RGD sequence) in the EGF-like domain. This gene is located on human chromosome 15q26.
면역원
MFGE8 (NP_005919, 61 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD
Sequence
YAGNHCETKCVEPLGMENGNIANSQIAASSVRVTFLGLQHWVPELARLNRAGMVNAWTPSSNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFD
생화학적/생리학적 작용
Milk fat globule epidermal growth factor 8 (Mfge8) controls inflammation and immunity by mediating apoptotic cell clearance. It plays an important role in autoimmunity, neoangiogenesis and sperm-egg binding. Mfge8 also plays a major role in membrane vesicle secretion like budding or shedding of plasma membrane (microvesicles) and exocytosis of endocytic multivesicular bodies (exosomes).
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Mfge8 diminishes the severity of tissue fibrosis in mice by binding and targeting collagen for uptake by macrophages
The Journal of Clinical Investigation, 119(12), 3713-3722 (2009)
Mutation Identification for Epilepsy in the US Hispanic Population Using Whole-Ex- ome-Sequencing
HSOA Journal of Cell Biology and Cell Metabolism, 3(011) (2016)
Secretion of a peripheral membrane protein, MFG-E8, as a complex with membrane vesicles
European Journal of Biochemistry, 269(4), 1209-1218 (2002)
The Journal of biological chemistry, 289(35), 24560-24572 (2014-07-10)
Tumor cells secrete factors that modulate macrophage activation and polarization into M2 type tumor-associated macrophages, which promote tumor growth, progression, and metastasis. The mechanisms that mediate this polarization are not clear. Macrophages are phagocytic cells that participate in the clearance
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.