WH0003146M8

Monoclonal Anti-HMGB1 antibody produced in mouse

clone 2F6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-DKFZp686A04236, Anti-HMG1, Anti-HMG3, Anti-SBP1, Anti-high-mobility group box 1
• MDL number: MFCD02263062
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2F6, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• GenBank 수납 번호: NM_002128
• UniProt 수납 번호: P09429
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HMGB1(3146)

설명

일반 설명

High mobility group box 1 (HMGB1) is a DNA binding protein, consisting of negatively charged amino acids in C-terminus and two DNA binding motifs, called BOX A and B. HMGB1 is mapped to human chromosome 13q12.3. Necrotic cells and neuritis express HMGB1. Monocytes and macrophages upon activation release HMGB1.

면역원

HMGB1 (NP_002119, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFK

애플리케이션

Monoclonal Anti-HMGB1 antibody produced in mouse has been used in the detection of HMGB1 in pancreatic ductal adenocarcinogenic (PDAC) cell lines using fluorescent microscopy. and in western blotting.

생화학적/생리학적 작용

High mobility group box 1 (HMGB1) functions to stabilize nucleosome and also regulates gene transcription. The phosphorylation of the nuclear localization signal in HMGB1 regulates its transport between cytoplasm and nucleus. It assists in nucleosome remodeling by eliciting chaperone functionality. Inflammation triggers high expression of HMGB1 and its inhibition may be useful for treating refractory M. pneumoniae pneumonia (RMPP). Elevated levels of HMGB1 is present in cardiovascular diseases. HMGB1 regulates autophagy in human liver cells in absence of oxygen followed reperfusion. High levels HMGB1 expression is seen in adenocarcinoma (AC), gall bladder and squamous cell/adenosquamous (SC/ASC) cancer. Polymorphisms in HMGB1 is present in oral squamous cell carcinoma (OSCC).

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)