WH0001785M1

Monoclonal Anti-DNM2 antibody produced in mouse

clone 6C9, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-DYN2, Anti-DYNII, Anti-dynamin 2
• MDL number: MFCD01633305
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 6C9, monoclonal
• 양식: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG1κ
• GenBank 수납 번호: BC054501
• UniProt 수납 번호: P50570
• 배송 상태: dry ice
• 저장 온도: −20°C
• 유전자 정보: human ... DNM2(1785)

설명

일반 설명

Dynamins represent one of the subfamilies of GTP-binding proteins. These proteins share considerable sequence similarity over the N-terminal portion of the molecule, which contains the GTPase domain. Dynamins are associated with microtubules. They have been implicated in cell processes such as endocytosis and cell motility, and in alterations of the membrane that accompany certain activities such as bone resorption by osteoclasts. Dynamins bind many proteins that bind actin and other cytoskeletal proteins. Dynamins can also self-assemble, a process that stimulates GTPase activity. Four alternatively spliced transcripts encoding different proteins have been described. Additional alternatively spliced transcripts may exist, but their full-length nature has not been determined. (provided by RefSeq)

면역원

DNM2 (AAH54501, 611 a.a. ~ 710 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLERQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLYSSADQSSLMEESAD

생화학적/생리학적 작용

DNM2 (dynamin 2) is a GTPase which is required for clathrin-mediated endocytosis. It is important for clathrin-coated pit maturation and clathrin-coated vesicle formation. DNM2 participates in neuronal morphology, axonal growth, centrosome cohesion, actin- and microtubular organization. Mutations in it are associated with Charcot-Marie-Tooth disease, centronuclear myopathy ADCNM (autosomal dominant centronuclear myopathy) and lethal congenital contractures syndrome type 5 (LCCS5). It is upregulated in prostate cancer.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)