WH0000917M1

Monoclonal Anti-CD3G antibody produced in mouse

clone 2A6, purified immunoglobulin, buffered aqueous solution

• 동의어(들): Anti-CD3G antigen, gamma polypeptide (TiT3 complex), Anti-CD3GAMMA, Anti-T3G
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2A6, monoclonal
• 형태: buffered aqueous solution
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• GenBank 수납 번호: NM_000073
• UniProt 수납 번호: P09693
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CD3G(917)

설명

일반 설명

The protein encoded by this gene is the CD3-gamma polypeptide, which together with CD3-epsilon, -delta and -zeta, and the T-cell receptor alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. This complex plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. The genes encoding the epsilon, gamma and delta polypeptides are located in the same cluster on chromosome 11. Defects in this gene are associated with T cell immunodeficiency. (provided by RefSeq)

면역원

CD3G (NP_000064, 23 a.a. ~ 111 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QSIKGNHLVKVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMYQCKGSQNKSKPLQVYYRMCQNCIELN

물리적 형태

Solution in phosphate buffered saline, pH 7.4

법적 정보

GenBank is a registered trademark of United States Department of Health and Human Services

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)