SAB5702975

Anti-DCAMKL1/DCLK1 Antibody, clone 8C8T3, Rabbit Monoclonal

• 동의어(들): CL1, CLICK1, DCAMKL1, DCDC3A, DCLK
• UNSPSC 코드: 12352203
• NACRES: NA.46
• 클론: 8C8T3, monoclonal
• application: WB
• 종 반응성: human, rat, rat
• 기술: western blot: 1:500 - 1:2000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 8C8T3, monoclonal
• 양식: liquid
• 종 반응성: human, rat, rat
• 농도: 0.57 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: QILMGQVDFPSPYWDNVSDSAKELITMMLLVDVDQRFSAVQVLEHPWVNDDGLPENEHQLSVAGKIKKHFNTGPKPNSTAAGVSVIATTALDKERQVFRRR
• UniProt 수납 번호: O15075
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DCLK1(9201)

설명

일반 설명

This gene encodes a member of the protein kinase superfamily and the doublecortin family. The protein encoded by this gene contains two N-terminal doublecortin domains, which bind microtubules and regulate microtubule polymerization, a C-terminal serine/threonine protein kinase domain, which shows substantial homology to Ca2+/calmodulin-dependent protein kinase, and a serine/proline-rich domain in between the doublecortin and the protein kinase domains, which mediates multiple protein-protein interactions. The microtubule-polymerizing activity of the encoded protein is independent of its protein kinase activity. The encoded protein is involved in several different cellular processes, including neuronal migration, retrograde transport, neuronal apoptosis and neurogenesis. This gene is up-regulated by brain-derived neurotrophic factor and associated with memory and general cognitive abilities. Multiple transcript variants generated by two alternative promoter usage and alternative splicing have been reported, but the full-length nature and biological validity of some variants have not been defined. These variants encode different isoforms, which are differentially expressed and have different kinase activities.[provided by RefSeq, Sep 2010]

면역원

A synthetic peptide corresponding to a sequence within amino acids 600-700 of human DCAMKL1/DCLK1 (O15075).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1