SAB5702948

Anti-E-Cadherin Antibody, clone 2Q9Y7, Rabbit Monoclonal

• 동의어(들): Arc-1,CD324,CDHE,ECAD,LCAM,UVO,CDH1,E-Cadherin
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 2Q9Y7, monoclonal
• 양식: liquid
• 분자량: 135 kDa
• 종 반응성: human, rat, rat
• 농도: 1.00 mg/mL
• 기술: immunofluorescence: 1:50 - 1:200; immunohistochemistry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• 색상: colorless
• 동형: IgG
• 면역원 서열: PVEAGLQIPAILGILGGILALLILILLLLLFLRRRAVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDARPEVTRNDVAPTLMSVPRYLPR
• UniProt 수납 번호: P12830
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: mouse ... CDH1(999)

설명

일반 설명

This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Mutations in this gene are correlated with gastric, breast, colorectal, thyroid and ovarian cancer. Loss of function of this gene is thought to contribute to cancer progression by increasing proliferation, invasion, and/or metastasis. The ectodomain of this protein mediates bacterial adhesion to mammalian cells and the cytoplasmic domain is required for internalization. This gene is present in a gene cluster with other members of the cadherin family on chromosome 16.

면역원

A synthetic peptide corresponding to a sequence within amino acids 700-800 of human E-Cadherin (NP_004351.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IHC, IF/ICC

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3