SAB5702916

Anti-S6 Ribosomal Protein (RPS6) Antibody, clone 4C7P4, Rabbit Monoclonal

• 동의어(들): RPS6,S6,RPS6
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 4C7P4, monoclonal
• 형태: liquid
• 분자량: 32 kDa
• 종 반응성: rat, human, rat
• 농도: 1 mg/mL
• 기술: immunofluorescence: 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP
• UniProt 수납 번호: P62753
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RPS6(6194)

설명

일반 설명

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

면역원

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2).

애플리케이션

WB, IF/ICC

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3