SAB5702770

Anti-PAX5 Antibody, clone 4I0X4, Rabbit Monoclonal

• 동의어(들): ALL3, BSAP
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 4I0X4, monoclonal
• 형태: liquid
• 분자량: 45 kDa
• 종 반응성: human
• 농도: 0.38 mg/mL
• 기술: immunohistochemistry: 1:50 - 1:200; immunoprecipitation (IP): 1:50 - 1:200; western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: DEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYP
• UniProt 수납 번호: Q02548
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PAX5(5079)

설명

일반 설명

This gene encodes a member of the paired box (PAX) family of transcription factors. The central feature of this gene family is a novel, highly conserved DNA-binding motif, known as the paired box. Paired box transcription factors are important regulators in early development, and alterations in the expression of their genes are thought to contribute to neoplastic transformation. This gene encodes the B-cell lineage specific activator protein that is expressed at early, but not late stages of B-cell differentiation. Its expression has also been detected in developing CNS and testis and so the encoded protein may also play a role in neural development and spermatogenesis. This gene is located at 9p13, which is involved in t(9;14)(p13;q32) translocations recurring in small lymphocytic lymphomas of the plasmacytoid subtype, and in derived large-cell lymphomas. This translocation brings the potent E-mu enhancer of the IgH gene into close proximity of the PAX5 promoter, suggesting that the deregulation of transcription of this gene contributes to the pathogenesis of these lymphomas. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

면역원

A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PAX5 (Q02548).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, IHC, IP

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1