SAB5702646

Anti-DLAT Antibody, clone 2Z7R10, Rabbit Monoclonal

• 동의어(들): DLTA, PDC-E2, PDCE2
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 2Z7R10, monoclonal
• 형태: liquid
• 분자량: 70 kDa
• 종 반응성: rat, rat, human
• 농도: 0.24 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: AREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLVPADNEKGFDVASMMSVTLSCDHRVVDGAVGAQWLAEFRKYLEKPITMLL
• UniProt 수납 번호: P10515
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DLAT(1737)

설명

일반 설명

This gene encodes component E2 of the multi-enzyme pyruvate dehydrogenase complex (PDC). PDC resides in the inner mitochondrial membrane and catalyzes the conversion of pyruvate to acetyl coenzyme A. The protein product of this gene, dihydrolipoamide acetyltransferase, accepts acetyl groups formed by the oxidative decarboxylation of pyruvate and transfers them to coenzyme A. Dihydrolipoamide acetyltransferase is the antigen for antimitochondrial antibodies. These autoantibodies are present in nearly 95% of patients with the autoimmune liver disease primary biliary cirrhosis (PBC). In PBC, activated T lymphocytes attack and destroy epithelial cells in the bile duct where this protein is abnormally distributed and overexpressed. PBC enventually leads to cirrhosis and liver failure. Mutations in this gene are also a cause of pyruvate dehydrogenase E2 deficiency which causes primary lactic acidosis in infancy and early childhood.[provided by RefSeq, Oct 2009]

면역원

A synthetic peptide corresponding to a sequence within amino acids 548-647 of human DLAT (P10515).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1