SAB5702432

Anti-Carbonic Anhydrase 1 (CA1) Antibody, clone 0G10F8, Rabbit Monoclonal

• 동의어(들): CA-I, CAB, Car1, HEL-S-11
• UNSPSC 코드: 12352203
• NACRES: NA.41
• 클론: 0G10F8, monoclonal
• application: WB
• 종 반응성: rat, mouse
• 기술: western blot: 1:500 - 1:2000

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 0G10F8, monoclonal
• 양식: liquid
• 분자량: 29 kDa
• 종 반응성: rat, mouse
• 농도: 0.75 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: KVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
• UniProt 수납 번호: P00915
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CA1(759)

설명

일반 설명

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. This CA1 gene is closely linked to the CA2 and CA3 genes on chromosome 8. It encodes a cytosolic protein that is found at the highest level in erythrocytes. Allelic variants of this gene have been described in some populations. Alternative splicing and the use of alternative promoters results in multiple transcript variants. [provided by RefSeq, Nov 2016]

면역원

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 160-261 of human Carbonic Anhydrase 1 (CA1) (CA1) (P00915).

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1