SAB5702342

[KO Validated]Anti-STAT2 Antibody, clone 4A5P8, Rabbit Monoclonal

• 동의어(들): IMD44, ISGF-3, P113, STAT113
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 4A5P8, monoclonal
• 형태: liquid
• 종 반응성: human, rat
• 농도: 1 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: KLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDEL
• UniProt 수납 번호: P52630
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... STAT2(6773)

설명

일반 설명

The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. In response to interferon (IFN), this protein forms a complex with STAT1 and IFN regulatory factor family protein p48 (ISGF3G), in which this protein acts as a transactivator, but lacks the ability to bind DNA directly. Transcription adaptor P300/CBP (EP300/CREBBP) has been shown to interact specifically with this protein, which is thought to be involved in the process of blocking IFN-alpha response by adenovirus. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2010]

면역원

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Recombinant fusion protein containing a sequence corresponding to amino acids 550-706 of human STAT2 (NP_005410.1).

애플리케이션

WB

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3