SAB5702269

Anti-CD68 Antibody, clone 5S2F7, Rabbit Monoclonal

• 동의어(들): CD68,GP110,LAMP4,SCARD1
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 5S2F7, monoclonal
• 양식: liquid
• 분자량: 80-130 kDa
• 종 반응성: human, rat, rat
• 농도: 1 mg/mL
• 기술: flow cytometry: 1:50 - 1:200; western blot: 1:500 - 1:1000
• 색상: colorless
• 동형: IgG
• 면역원 서열: TSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNK
• UniProt 수납 번호: P34810
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CD68(968)

설명

일반 설명

This gene encodes a 110-kD transmembrane glycoprotein that is highly expressed by human monocytes and tissue macrophages. It is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. The protein primarily localizes to lysosomes and endosomes with a smaller fraction circulating to the cell surface. It is a type I integral membrane protein with a heavily glycosylated extracellular domain and binds to tissue- and organ-specific lectins or selectins. The protein is also a member of the scavenger receptor family. Scavenger receptors typically function to clear cellular debris, promote phagocytosis, and mediate the recruitment and activation of macrophages. Alternative splicing results in multiple transcripts encoding different isoforms.

면역원

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CD68 (NP_001242.2).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB, FC

안전성 정보

• 픽토그램: GHS07,GHS09
• 신호어: Warning
• 유해 및 위험 성명서: H317,H411
• 예방조치 성명서: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Hazard Classifications: Aquatic Chronic 2 - Skin Sens. 1
• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3