SAB5701962

[KO Validated]Anti-FGFR2 Antibody, clone 0O6A9, Rabbit Monoclonal

• 동의어(들): BBDS,BEK,BFR-1,CD332,CEK3,CFD1,ECT1,JWS,K-SAM,KGFR,TK14,TK25,FGFR2
• UNSPSC 코드: 12352203
• NACRES: NA.46

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• material: colorless
• 클론: 0O6A9, monoclonal
• 형태: liquid
• 분자량: 145 kDa
• 종 반응성: human, rat, rat
• 농도: 1.5 mg/mL
• 기술: western blot: 1:500 - 1:2000
• 색상: colorless
• 동형: IgG
• 면역원 서열: MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEVRCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPR
• UniProt 수납 번호: P21802
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... FGFR2(2263)

설명

일반 설명

The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. Mutations in this gene are associated with Crouzon syndrome, Pfeiffer syndrome, Craniosynostosis, Apert syndrome, Jackson-Weiss syndrome, Beare-Stevenson cutis gyrata syndrome, Saethre-Chotzen syndrome, and syndromic craniosynostosis. Multiple alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Jan 2009]

면역원

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human FGFR2 (P21802).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

애플리케이션

WB

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1