SAB2108937

Anti-G6PC3 (N-terminal) antibody produced in rabbit HRP conjugated

affinity isolated antibody

• 동의어(들): HYA1, HYAL1, HYAL3, HYAL5, MGC26532
• UNSPSC 코드: 12352203
• NACRES: NA.45

속성

• 생물학적 소스: rabbit
• 결합: peroxidase conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 39 kDa
• 종 반응성(상동성에 의해 예측): rabbit, mouse, human, bovine, horse, canine, zebrafish, guinea pig, rat
• 농도: 0.5 mg/mL
• NCBI 수납 번호: NM_138387
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... G6PC3(92579)

설명

일반 설명

This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.

면역원

Synthetic peptide directed towards the N-terminal region of Human G6PC3

서열

Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable