SAB2108829

Anti-DAG1 antibody produced in rabbit HRP conjugted

affinity isolated antibody

• 동의어(들): HPE9, THP1, THP2
• UNSPSC 코드: 12352203
• NACRES: NA.45

속성

• 생물학적 소스: rabbit
• 결합: peroxidase conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 27 kDa
• 종 반응성(상동성에 의해 예측): bovine, horse, zebrafish, canine, pig, human, rabbit, mouse, guinea pig
• 농도: 0.5 mg/mL
• 기술: immunohistochemistry (formalin-fixed, paraffin-embedded sections): 4-8 μg/mL
• NCBI 수납 번호: NM_004393
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... DAG1(1605)

설명

일반 설명

This gene encodes dystroglycan, a central component of dystrophin-glycoprotein complex that links the extracellular matrix and the cytoskeleton in the skeletal muscle. The encoded preproprotein undergoes O- and N-glycosylation, and proteolytic processing to generate alpha and beta subunits. Certain mutations in this gene are known to cause distinct forms of muscular dystrophy. Alternative splicing results in multiple transcript variants, all encoding the same protein.

면역원

Synthetic peptide directed towards the middle region of human alpha-DAG1

서열

Synthetic peptide located within the following region: AIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPVPGKPTVTIRT

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable