SAB2108787

Anti-THRA antibody produced in rabbit biotin conjugated

affinity isolated antibody

• 동의어(들): ENV, ENVW, ERVWE1, HERV-7q, HERV-W-ENV
• UNSPSC 코드: 12352203
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• 결합: biotin conjugate
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 55 kDa
• 종 반응성(상동성에 의해 예측): human, zebrafish, mouse, bovine, rabbit, rat, horse, guinea pig, canine
• 농도: 0.5 mg/mL
• NCBI 수납 번호: NM_003250
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... THRA(7067)

설명

일반 설명

The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.

면역원

Synthetic peptide directed towards the middle region of human THRA

서열

Synthetic peptide located within the following region: DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVV

물리적 형태

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: nwg
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable