SAB2108514

Anti-TGFB1

affinity isolated antibody

• 동의어(들): Anti- TGF-beta1, Anti- TGFbeta1, Anti- Tgfb-1, Anti-Tgfb
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 43 kDa
• 종 반응성: mouse, human
• 농도: 0.5-1 mg/mL
• 기술: immunoblotting: suitable; immunofluorescence: suitable; immunohistochemistry: suitable
• 수납 번호(accession number): NM_011577
• UniProt 수납 번호: P04202
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TGFB1(21803)

설명

면역원

Synthetic peptide directed towards the middle region of mouse TGFB1

생화학적/생리학적 작용

Tgfb1 is a multifunctional protein that control proliferation, differentiation, and other functions in many cell types. Many cells synthesize TGFB1 and essentially all of them have specific receptors for this protein. It regulates the actions of many other growth factors and determines a positive or negative direction of their effects. It plays an important role in bone remodelling. It is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.

서열

Synthetic peptide located within the following region: DTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNKLHVEINGIS

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable