추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
53 kDa
종 반응성
horse, human, rabbit, pig, mouse, goat, bovine, rat
농도
0.5-1 mg/mL
기술
immunoblotting: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TFEB(7942)
일반 설명
Transcription factor EB (TFEB) is encoded by the gene mapped to human chromosome 6p21.1. The encoded protein belongs to the MiT transcription factor family. TFEB is widely expressed and is characterized with a transactivation domain, basic-helix-loop-helix domain, glutamine rich region, leucine zipper region and proline rich region.
면역원
Synthetic peptide directed towards the middle region of human TFEB
생화학적/생리학적 작용
Transcription factor EB (TFEB) plays a key role in the regulation of autophagy and lysosome biogenesis. TFEB, expressed in endothelial cells, reduces inflammation and hinders atherosclerosis development. Thus, this protein can be considered as a potent therapeutic target for atherosclerosis and associated cardiovascular diseases.
서열
Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
The Transcription Factor EB Links Cellular Stress to the Immune Response
The Yale Journal of Biology and Medicine, 90(2), 301-315 (2017)
TFEB inhibits endothelial cell inflammation and reduces atherosclerosis.
Science Signaling, 10(464) (2017)
Molecular Genetics and Cellular Characteristics of TFE3 and TFEB Translocation Renal Cell Carcinomas
Nature reviews. Urology, 11(8), 465-465 (2014)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.