SAB2107910

Anti-SMARCB1 antibody produced in rabbit

affinity isolated antibody

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 44kDa
• 종 반응성: human, horse, mouse, bovine, dog, guinea pig, rat
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunoblotting: suitable; immunohistochemistry: suitable
• NCBI 수납 번호: NM_003073
• UniProt 수납 번호: Q12824
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SMARCB1(6598)

설명

면역원

Synthetic peptide directed towards the N terminal region of human SMARCB1

생화학적/생리학적 작용

The protein encoded by SMARCB1 is part of a complex that relieves repressive chromatin structures, allowing the transcriptional machinery to access its targets more effectively. The encoded nuclear protein may also bind to and enhance the DNA joining activity of HIV-1 integrase. SMARCB1 has been found to be a tumor suppressor, and mutations in it have been associated with malignant rhabdoid tumors.

서열

Synthetic peptide located within the following region: RGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable