추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
40 kDa
종 반응성
mouse, human, guinea pig, dog, rabbit, rat
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ATP6V0D2(245972)
관련 카테고리
일반 설명
Adenosine triphosphatase V0 (ATP6V0D2) is located on human chromosome 8q21. Atp6v0d2 is an isoform of vacuolar (H+) ATPase (v-ATPase) proton pump. ATP6V0D2 is expressed abundantly in mature osteoclasts.
면역원
Synthetic peptide directed towards the middle region of human ATP6V0D2
생화학적/생리학적 작용
Adenosine triphosphatase V0 (ATP6V0D2) helps in osteoclast maturation and bone formation. Insulin activates ATP6V0D2 through extracellular-signal-regulated kinase (ERK)1/2 pathway.
서열
Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
v-ATPase V 0 subunit d2-deficient mice exhibit impaired osteoclast fusion and increased bone formation
Lee, Seou, et al.
Nature Medicine, 12(12), 1403-1403 (2006)
Insulin enhances RANKL-induced osteoclastogenesis via ERK1/2 activation and induction of NFATc1 and Atp6v0d2
Oh, Ju He, et al.
Cellular Signalling, 27(12), 2325-2331 (2015)
Integrated differential transcriptome maps of Acute Megakaryoblastic Leukemia (AMKL) in children with or without Down Syndrome (DS)
Pelleri,, et al.
BMC Medical Genomics, 7(1), 63-63 (2014)
Na Liu et al.
The Journal of clinical investigation, 129(2), 631-646 (2018-11-16)
Macrophages perform key functions in tissue homeostasis that are influenced by the local tissue environment. Within the tumor microenvironment, tumor-associated macrophages can be altered to acquire properties that enhance tumor growth. Here, we found that lactate, a metabolite found in
Weihao Zheng et al.
PLoS pathogens, 20(5), e1012205-e1012205 (2024-05-03)
Mycobacterium tuberculosis (Mtb) infects lung myeloid cells, but the specific Mtb-permissive cells and host mechanisms supporting Mtb persistence during chronic infection are incompletely characterized. We report that after the development of T cell responses, CD11clo monocyte-derived cells harbor more live
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.