SAB2103083

Anti-TRIM33 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ32925, Anti-PTC7, Anti-RFG7, Anti-TF1G, Anti-TIF1G
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 122 kDa
• 종 반응성: guinea pig, bovine, rat, mouse, human, horse, rabbit, dog
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunofluorescence: suitable; western blot: suitable
• NCBI 수납 번호: NM_015906
• UniProt 수납 번호: Q9UPN9
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... TRIM33(51592)

설명

면역원

Synthetic peptide directed towards the middle region of human TRIM33

생화학적/생리학적 작용

TRIM33 is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region.The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

서열

Synthetic peptide located within the following region: EIYSDRTFAPLPEFEQEEDDGEVTEDSDEDFIQPRRKRLKSDERPVHIK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable