SAB2102661

Anti-USP18 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-ISG43, Anti-UBP43, Anti-Ubiquitin specific peptidase 18
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 43 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• UniProt 수납 번호: Q9UMW8
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... USP18(11274)

설명

면역원

Synthetic peptide directed towards the N terminal region of human USP18

생화학적/생리학적 작용

USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.USP18, a member of the deubiquitinating protease family of enzymes, removes ubiquitin adducts from a broad range of protein substrates.[supplied by OMIM]. Sequence Note: The RefSeq transcript and protein were derived from genomic sequence to make the sequence consistent with the reference genome assembly. The genomic coordinates used for the transcript record were based on alignments. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-232 AC008079.24 80964-81195 233-495 AC008079.24 88531-88793 496-592 AC008079.24 91145-91241 593-738 AC008079.24 92763-92908 739-818 AC008079.24 98228-98307 819-965 AC008079.24 98863-99009 966-1061 AC008079.24 100817-100912 1062-1229 AC008079.24 101726-101893 1230-1361 AC008079.24 104123-104254 1362-1411 AC008079.24 104766-104815 1412-2037 AC008079.24 107745-108370

서열

Synthetic peptide located within the following region: MQDSRQKAVRPLELAYCLQKCNVPLFVQHDAAQLYLKLWNLIKDQITDVH

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable