SAB2102632

Anti-UBQLN1 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-DA41, Anti-DSK2, Anti-FLJ90054, Anti-PLIC-1, Anti-Ubiquilin 1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 62 kDa
• 종 반응성: guinea pig, rat, human, dog, bovine, horse, rabbit, sheep
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunohistochemistry: suitable; western blot: suitable
• UniProt 수납 번호: Q9UMX0
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... UBQLN1(29979)

설명

일반 설명

The previously assigned protein identifier Q5T6J9 has been merged into Q9UMX0. Full details can be found on the UniProt database.

면역원

Synthetic peptide directed towards the middle region of human UBQLN1

생화학적/생리학적 작용

UBQLN1 is an ubiquitin-like protein (ubiquilin) that shares a high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain an N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and it is found in lesions associated with Alzheimer′s and Parkinson′s disease. Two transcript variants encoding different isoforms have been found for this gene.This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus are thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to modulate accumulation of presenilin proteins, and is found in lesions associated with Alzheimer′s and Parkinson′s disease. Two transcript variants encoding different isoforms have been found for this gene.

서열

Synthetic peptide located within the following region: QFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTA

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable