SAB2102460

Anti-TMEM16A antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-FLJ10261, Anti-ORAOV2, Anti-TAOS2, Anti-Transmembrane protein 16A
• UNSPSC 코드: 12352203

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: lyophilized powder
• 분자량: 111 kDa
• 종 반응성: rat, guinea pig, mouse, bovine, human, rabbit, horse
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... TMEM16A(55107)

설명

면역원

The immunogen for anti-TMEM16A antibody: synthetic peptide derected towards the middle region of human TMEM16A

서열

Synthetic peptide located within the following region: HGFVNHTLSSFNVSDFQNGTAPNDPLDLGYEVQICRYKDYREPPWSENKY

물리적 형태

Lyophilized from PBS buffer with 2% sucrose

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable