콘텐츠로 건너뛰기
Merck
모든 사진(3)

Key Documents

SAB2101578

Sigma-Aldrich

Anti-NFATC3 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-NFAT4, Anti-NFATX, Anti-Nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 3

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

형태

buffered aqueous solution

분자량

115 kDa

종 반응성

dog, mouse, human, horse, bovine

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... NFATC3(4775)

일반 설명

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) belongs to the NFAT family. It is expressed at high levels in the thymus. NFATc3 has a rel similarity domain (RSD) and the SP repeat region, characterized by the repeated motif SPxxSPxxSPrxsxx(D/E)(D/E)swl. The NFATc3 gene is located on human chromosome 16.

면역원

Synthetic peptide directed towards the N terminal region of human NFATC3

애플리케이션

Anti-NFATC3 antibody produced in rabbit has been used in western blot analysis (1:1000).

생화학적/생리학적 작용

The nuclear factor of activated T cells 3 (NFATc3)/nuclear factor of activated T cells 4 (NFAT4) exhibits either pro-tumor or anti-tumor effects. It can block the proliferation and migration abilities of hepatoma cells. NFATc3 aids in reducing hepatitis B virus (HBV) replication. It can activate transcription. NFAT4 is necessary to drive the expression of the human polyomavirus JC virus (JCV) gene in glial cells.

서열

Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Xiaobin Zao et al.
Oncoimmunology, 10(1), 1869388-1869388 (2021-02-02)
Nuclear factor of activated T cells 3 (NFATc3) has been reported to upregulate type I interferons (IFNs) expression, and the abnormal expression and activation of NFATc3 were closely related to tumorigenesis. However, the potential function of NFATc3 in hepatitis B
S N Ho et al.
The Journal of biological chemistry, 270(34), 19898-19907 (1995-08-25)
Signals transduced by the T cell antigen receptor (TCR) regulate developmental transitions in the thymus and also mediate the immunologic activation of mature, peripheral T cells. In both cases TCR stimulation leads to the assembly of the NFAT transcription complex
Kate Manley et al.
Journal of virology, 80(24), 12079-12085 (2006-10-13)
The human polyomavirus JC virus (JCV) infects 70% of the population worldwide. In immunosuppressed patients, JCV infection can lead to progressive multifocal leukoencephalopathy (PML), a fatal demyelinating disease of the central nervous system (CNS). The majority of PML cases occur
Patrick Nasarre et al.
Cancers, 13(11) (2021-06-03)
Secreted frizzled-related protein 2 (SFRP2) promotes the migration/invasion of metastatic osteosarcoma (OS) cells and tube formation by endothelial cells. However, its function on T-cells is unknown. We hypothesized that blocking SFRP2 with a humanized monoclonal antibody (hSFRP2 mAb) can restore

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.