SAB2101339

Anti-LGALS9 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-ECALECTIN, Anti-HUAT, Anti-Lectin, galactoside-binding, soluble, 9 (galectin 9), Anti-MGC117375, Anti-MGC125973
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: 39 kDa
• 종 반응성: human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• UniProt 수납 번호: O00182
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... LGALS9(3965)

설명

면역원

Synthetic peptide directed towards the middle region of human LGALS9

생화학적/생리학적 작용

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS9 is an S-type lectin. It is overexpressed in Hodgkin′s disease tissue and might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its associated immunodeficiency.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. This galectin is strongly overexpressed in Hodgkin′s disease tissue and it might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its consistently associated immunodeficiency. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene.

서열

Synthetic peptide located within the following region: YPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFH

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable