생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
형태
buffered aqueous solution
분자량
38 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... DNAJB1(3337)
일반 설명
DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) belongs to the heat shock protein 40 (HSP40) protein family. It contains a highly conserved J domain. The DNAJB1 gene is mapped to human chromosome 19p13.12.
면역원
Synthetic peptide directed towards the N terminal region of human DNAJB1
애플리케이션
Anti-DNAJB1 antibody produced in rabbit has been used in western blotting (1:500).
생화학적/생리학적 작용
DnaJ (Hsp40) homolog, subfamily B, member 1 (DNAJB1) interacts with heat shock protein 70 (HSP70) and can stimulate its ATPase activity. It stimulates the association between heat shock cognate 70 kDa protein (HSC70) and Hsc70-interacting protein (HIP). In association with HSP70, HSP40 favors adenosine triphosphate (ATP)-dependent protein refolding, transport, and interaction. It acts as a negative regulator melanoma differentiation-associated gene 5 (MDA5) based mitochondrial antiviral signaling protein pathway and mitogen-inducible gene 6 (MIG6). It also blocks p53 mediated apoptosis by destabilizing programmed cell death 5 (PDCD5). Hsp40 mediates viral ribonucleoproteins (vRNPs) import and may serve as a potential antiviral target.
서열
Synthetic peptide located within the following region: GSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Xiao-Ting Feng et al.
BMC developmental biology, 19(1), 9-9 (2019-04-27)
Coilia nasus oogenesis/spawning migration is a well-defined synchronous arrangement process. DnaJs are indispensable molecular chaperones for oogenesis process. However, how DnaJs involved the anadromous spawning migration mechanism is outstanding and plausible. In this regard, two DnaJs (Cn-DnaJa1 and Cn-DnaJb1) are
Soo-Yeon Park et al.
Biochimica et biophysica acta, 1853(10 Pt A), 2722-2730 (2015-08-05)
Mitogen-inducible gene 6 (MIG6) is a tumor suppressor implicated in the development of human cancers; however, the regulatory mechanisms of MIG6 remain unknown. Here, using a yeast two-hybrid screen, we identified DnaJ homolog subfamily B member I (DNAJB1) as a
Monika Vyas et al.
Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc, 33(4), 648-656 (2019-11-05)
Recently discovered DNAJB1-PRKACA oncogenic fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma. In this study, we describe six pancreatobiliary neoplasms with PRKACA fusions, five of which harbor the DNAJB1-PRKACA fusion. All neoplasms were subjected to a hybridization capture-based next-generation
Jyoti Batra et al.
Scientific reports, 6, 19063-19063 (2016-01-12)
A unique feature of influenza A virus (IAV) life cycle is replication of the viral genome in the host cell nucleus. The nuclear import of IAV genome is an indispensable step in establishing virus infection. IAV nucleoprotein (NP) is known
Ken Takashima et al.
Journal of innate immunity, 10(1), 44-55 (2017-10-27)
Melanoma differentiation-associated gene 5 (MDA5) is a pattern recognition receptor that recognizes cytoplasmic viral double-stranded RNA (dsRNA) and initiates rapid innate antiviral responses. MDA5 forms a filament-like multimer along the dsRNA leading to oligomerization, which in turn activates the adaptor
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.