SAB1413286

Monoclonal Anti-SPINK6 antibody produced n mouse

clone 3C10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): SPINK6
• UNSPSC 코드: 51111800

속성

• 결합: unconjugated
• Quality Level: 100
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 3C10, monoclonal
• 양식: buffered aqueous solution
• 분자량: 35 kDa
• 종 반응성: human
• 농도: ~0.3-1 μg/μL (Please refer to lot specific concentration)
• 기술: ELISA: suitable; western blot: suitable
• 동형: IgG1, kappa
• 단백질 ID 수납 번호: BC032003.1
• 배송 상태: dry ice
• 저장 온도: -10 to -25°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SPINK6(404203)

설명

일반 설명

Mouse monoclonal antibody raised against a full-length recombinant SPINK6.

면역원

SPINK6 (AAH32003.1, 1 a.a. ~ 80 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

서열

MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDTKVYCTRESNPHCGSDGQTYGNKCAFCKAIVKSGGKISLKHPGKC

물리적 형태

Solution in phosphate buffered saline, pH 7.4

제조 메모

Purification by Protein A sepharose

저장 및 안정성

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable