SAB1413281

Monoclonal Anti-RLF antibody produced in mouse

clone 2G2, purified immunoglobulin, buffered aqueous solution

• 동의어(들): RLF
• UNSPSC 코드: 51111800

속성

• 결합: unconjugated
• Quality Level: 100
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2G2, monoclonal
• 양식: buffered aqueous solution
• 분자량: 37.73 kDa
• 종 반응성: human
• 농도: ~0.3-1 μg/μL
• 기술: ELISA: suitable; western blot: suitable
• 동형: IgG2a, kappa
• 단백질 ID 수납 번호: NM_012421
• 배송 상태: dry ice
• 저장 온도: -10 to -25°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... RLF(6018)

설명

일반 설명

Mouse monoclonal antibody raised against a partial recombinant RLF.

면역원

RLF (NP_036553.1, 1805 a.a. ~ 1913 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

서열

SNDLTGNVVANNMVNDSEPEVDIPHSSSDSTIHENLTAIPPLIVAETTTVPSLENLRVVLDKALTDCGELALKQLHYLRPVVVLERSKFSTPILDLFPTKKTDELCVGS

물리적 형태

Solution in phosphate buffered saline, pH 7.4

제조 메모

Purification by Protein A sepharose

저장 및 안정성

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 2
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable