SAB1409259

Monoclonal Anti-JAG2 antibody produced in mouse

clone 2D10, purified immunoglobulin, buffered aqueous solution

• 동의어(들): HJ2, SER2
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2D10, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen 36.41 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_002226
• UniProt 수납 번호: Q9Y219
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... JAG2(3714)

설명

일반 설명

The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)

면역원

JAG2 (NP_002217, 869 a.a. ~ 966 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
GRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRDCSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCLPRSGHL

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable