SAB1409018

Anti-AKR1B1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• 동의어(들): ADR, ALDR1, ALR2, AR, MGC1804
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: antigen 34.76 kDa
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: BC000260
• UniProt 수납 번호: P15121
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... AKR1B1(231)

설명

일반 설명

This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member catalyzes the reduction of a number of aldehydes, including the aldehyde form of glucose, and is thereby implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol. Multiple pseudogenes have been identified for this gene. The nomenclature system used by the HUGO Gene Nomenclature Committee to define human aldo-keto reductase family members is known to differ from that used by the Mouse Genome Informatics database. (provided by RefSeq)

면역원

AKR1B1 (AAH00260, 1 a.a. ~ 316 a.a) full-length human protein.

Sequence
MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF

생화학적/생리학적 작용

Aldo-keto reductase family 1, member B1 (AKR1B1) takes part in the reduction of aldehydes. It can be induced by proteasome inhibitors in human colon cancer cell lines HT-29 and SW-480.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable