SAB1405974

Anti-HTN1 antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

• 동의어(들): HIS1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~7 kDa
• 종 반응성: human
• 기술: western blot: 1 μg/mL
• NCBI 수납 번호: NM_002159.2
• UniProt 수납 번호: P15515
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... HTN1(3346)

설명

일반 설명

Histatin 1 (HTN1) is a histidine-rich phosphoprotein.HTN1 functions as an antimicrobial peptide with 38 amino acids. It is highly enriched in human saliva. HTN1 gene is located on human chromosome 4q13.3.

면역원

HTN1 (NP_002150.1, 1 a.a. ~ 57 a.a) full-length human protein.

Sequence
MKFFVFALVLALMISMISADSHEKRHHGYRRKFHEKHHSHREFPFYGDYGSNYLYDN

생화학적/생리학적 작용

Histatin 1 (HTN1) promotes migration of oral keratinocytes and fibroblasts in vitro. It also contributes to endothelial cell adhesion, migration and angiogenesis. HTN1 helps in oral wound healing. HTN1 is used as a marker for human lacrimal epithelium in accessory lacrimal gland (ALG) and cadaveric main lacrimal gland (MLG). HTN1 also has candidacidal activity and helps in mineralization by adsorbing to hydroxyapatite.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable