SAB1405223

Monoclonal Anti-CPNE5 antibody produced in mouse

clone 2G4, ascites fluid

• 동의어(들): COPN5, CPN5, DKFZp666C234, KIAA1599
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 2G4, monoclonal
• 분자량: antigen ~32.49 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1:500-1:1000
• 동형: IgG1κ
• NCBI 수납 번호: NM_020939
• UniProt 수납 번호: Q9HCH3
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CPNE5(57699)

설명

일반 설명

Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. (provided by RefSeq)

면역원

CPNE5 (NP_065990, 393 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAAVQD

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable