SAB1404589

Monoclonal Anti-MMP23B antibody produced in mouse

clone 1D8, purified immunoglobulin, buffered aqueous solution

• 동의어(들): MIFR, MIFR-1, MMP22
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1D8, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~37.11 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: NM_006983
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... MMP23B(8510)

설명

일반 설명

This gene (MMP23B) encodes a member of the matrix metalloproteinase (MMP) family, and it is part of a duplicated region of chromosome 1p36.3. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. This gene belongs to the more telomeric copy of the duplicated region. (provided by RefSeq)

면역원

MMP23B (NP_008914, 241 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LSQDELWGLHRLYGCLDRLFVCASWARRGFCDARRRLMKRLCPSSCDFCYEFPFPTVATTPPPPRTKTRLVPEGRNVTFRCGQKILHKKGKVYWYKDQEP

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable