SAB1403985

Monoclonal Anti-IPF1 antibody produced in mouse

clone 4E12, purified immunoglobulin, buffered aqueous solution

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4E12, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~37 kDa
• 종 반응성: human
• 기술: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG
• NCBI 수납 번호: NM_000209
• UniProt 수납 번호: P52945
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PDX1(3651)

설명

일반 설명

The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). (provided by RefSeq)

면역원

IPF1 (NP_000200, 109 a.a. ~ 208 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK

물리적 형태

Solution in phosphate buffered saline, pH 7.4

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable