추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3A6, monoclonal
형태
buffered aqueous solution
분자량
antigen ~38.1 kDa
종 반응성
human
기술
capture ELISA: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG1κ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC5A3(6526)
관련 카테고리
일반 설명
Solute carrier family 5 member 3 (SLC5A3) is a member of SLC5A gene family, which shares five transmembrane segment inverted repeats of the LeuT structural family. SLC5A3 is expressed in brain, kidney and placenta. SLC5A3 gene is located on human chromosome 21q22.11.
면역원
SLC5A3 (NP_008864, 533 a.a. ~ 641 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
Sequence
TPPPTKEQIRTTTFWSKKNLVVKENCSPKEEPYKMQEKSILRCSENNETINHIIPNGKSEDSIKGLQPEDVNLLVTCREEGNPVASLGHSEAETPVDAYSNGQAALMGE
애플리케이션
Monoclonal Anti-SLC5A3 antibody produced in mouse has been used in dSTORM (direct stochastic optical reconstruction microscopy).
생화학적/생리학적 작용
Solute carrier family 5 member 3 (SLC5A3) functions in cellular osmoregulation. Overexpression of SLC5A3 contributes to pathophysiology of Down syndrome. SLC5A3 acts as a transporter in hypotonic volume regulation of mammalian cells. SLC5A3 regulates millimolar intracellular concentrations of myo-inositol and promotes transepithelial myo-inositol transport in kidney, intestine, retina and choroid plexus.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
The structural organization of the human Na+/myo-inositol cotransporter (SLC5A3) gene and characterization of the promoter
Mallee J, et al.
Genomics, 46(3) (1997)
Human Na+-myo-inositol cotransporter gene: alternate splicing generates diverse transcripts
Porcellati F, et al.
American Journal of Physiology. Cell Physiology, 274(5) (1998)
Joseph Andronic et al.
PloS one, 10(3), e0119990-e0119990 (2015-03-11)
Swelling-activated pathways for myo-inositol, one of the most abundant organic osmolytes in mammalian cells, have not yet been identified. The present study explores the SLC5A3 protein as a possible transporter of myo-inositol in hyponically swollen HEK293 cells. To address this
Hypotonic activation of the myo-inositol transporter SLC5A3 in HEK293 cells probed by cell volumetry, confocal and super-resolution microscopy
Andronic J, et al.
PLoS ONE, 10(3), e0119990-e0119990 (2015)
The transport mechanism of the human sodium/myo-inositol transporter 2 (SMIT2/SGLT6), a member of the LeuT structural family
Sasseville L, et al.
American Journal of Physiology. Cell Physiology, 307(5) (2014)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.