SAB1402879

Monoclonal Anti-PRELP antibody produced in mouse

clone 3H1, ascites fluid

• 동의어(들): MGC45323, MST161, MSTP161, SLRR2A
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: ascites fluid
• 항체 생산 유형: primary antibodies
• 클론: 3H1, monoclonal
• 분자량: antigen ~35.46 kDa
• 종 반응성: human
• 기술: indirect ELISA: suitable; western blot: 1:500-1:1000
• 동형: IgMκ
• NCBI 수납 번호: NM_002725
• UniProt 수납 번호: P51888
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PRELP(5549)

설명

일반 설명

The protein encoded by this gene is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage. Alternatively spliced transcript variants encoding the same protein have been observed. (provided by RefSeq)

면역원

PRELP (NP_002716.1, 281 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RGLPKNSFNISNLLVLHLSHNRISSVPAINNRLEHLYLNNNSIEKINGTQICPNDLVAFHDFSSDLENVPHLRYLRLDGNYLKPP

물리적 형태

Clear solution

안전성 정보

• Storage Class Code: 11 - Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable