추천 제품
생물학적 소스
mouse
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
1E6, monoclonal
형태
buffered aqueous solution
분자량
antigen ~36.89 kDa
종 반응성
human
기술
immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
NCBI 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SOX10(6663)
일반 설명
Anti-AURA Antibody detects endogenous levels of total AURA protein.
SOX10 (SRY-box 10) is a co-transcription factor that is located on human chromosome 22q13. SOX10 is temporarily expressed in melanoblasts.
This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional activator after forming a protein complex with other proteins. This protein acts as a nucleocytoplasmic shuttle protein and is important for neural crest and peripheral nervous system development. Mutations in this gene are associated with Waardenburg-Shah and Waardenburg-Hirschsprung disease. (provided by RefSeq)
면역원
SOX10 (NP_008872, 336 a.a. ~ 433 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
Sequence
KPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQR
생화학적/생리학적 작용
SOX10 (SRY-box 10) regulates the expression of ErbB3 in neural crest cells. It is required for differentiation of peripheral glia. SOX10 plays an important role in the progression of melanocytes. Mutations in SOX10 result in Waardenburg syndrome and Hirschsprung disease.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Not finding the right product?
Try our 제품 선택기 도구.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
시험 성적서(COA)
제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.
Takuya E Kishimoto et al.
Veterinary pathology, 55(5), 634-644 (2018-06-02)
Oligodendroglioma is a common brain tumor in dogs, particularly brachycephalic breeds. Oligodendrocyte precursor cells (OPCs) are suspected to be a possible origin of oligodendroglioma, although it has not been well elucidated. In the present study, 27 cases of canine brain
Interaction among SOX10, PAX3 and MITF, three genes altered in Waardenburg syndrome
Bondurand N, et al.
Human Molecular Genetics, 9(13), 1907-1917 (2000)
The SOX10/Sox10 gene from human and mouse: sequence, expression, and transactivation by the encoded HMG domain transcription factor
Pusch C, et al.
Human Genetics, 103(2), 115-123 (1998)
The transcription factor Sox10 is a key regulator of peripheral glial development
Britsch S, et al.
Genes & Development, 15(1), 66-78 (2001)
SOX10-Nano-Lantern Reporter Human iPS Cells; A Versatile Tool for Neural Crest Research
Horikiri T, et al.
PLoS ONE (2017)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.