SAB1402301

Monoclonal Anti-PCP4 antibody produced in mouse

clone 1E3, purified immunoglobulin, buffered aqueous solution

• 동의어(들): PEP-19
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 1E3, monoclonal
• 형태: buffered aqueous solution
• 분자량: antigen ~32.93 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_006198
• UniProt 수납 번호: P48539
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... PCP4(5121)

설명

일반 설명

Purkinje cell protein 4 (PCP4) is an anti-apoptotic, calmodulin-binding peptide which is expressed in neural cells. It is also expressed in the Purkinje cells of the cerebellum, kidneys, prostate and the uterus. PCP4 is a 7.6kDa with an IQ-motif. The gene encoding this protein is localized on human chromosome 21q22.2.

면역원

PCP4 (NP_006189.2, 1 a.a. ~ 62 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSERQGAGATNGKDKTSGENDGQKKVQEEFDIDMDAPETERAAVAIQSQFRKFQKKKAGSQS

생화학적/생리학적 작용

Purkinje cell protein 4 (PCP4) may have a role in apoptosis and cellular degeneration. It acts as an accelerator of calcium association and disassociation with calmodulin. The protein also functions in synaptic plasticity.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable