재조합
expressed in E. coli LysA ArgA BL21(DE3)
분석
>80% (SDS-PAGE)
양식
buffered aqueous solution
분자량
predicted mol wt 26kDa including tags
정제법
immobilized metal affinity chromatography (IMAC)
포장
pkg of 1nmol × 5 vials
저장 조건
avoid repeated freeze/thaw cycles
면역원 서열
LNSSTRNSKSNVKMFSVSKLIAQETIMESLDGLHLPESSRETTAMILMNVYCNKILKPVDGSCCQPRPPVTL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... CASD1(64921)
일반 설명
Lys, Arg 13C and 15N metabolically labeled recombinant human protein fragment
애플리케이션
Internal standard in MS-based quantitative proteomics
물리적 형태
Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4
제조 메모
The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.
분석 메모
Isotopic Label Incorporation
The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.
A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.
All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:
GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.
The specific human protein sequence begins directly after ′VDKLAAA′.
GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.
The specific human protein sequence begins directly after ′VDKLAAA′.
법적 정보
This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected]
SILu is a trademark of Sigma-Aldrich Co. LLC
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.