QPREST21414

SILu^™PrEST PLXC1

SILuPrESTs Powered by Atlas Antibodies, buffered aqueous solution

• 동의어(들): Virus-encoded semaphorin protein receptor
• UNSPSC 코드: 12352200

속성

• 재조합: expressed in E. coli LysA ArgA BL21(DE3)
• 분석: >80% (SDS-PAGE)
• 양식: buffered aqueous solution
• 분자량: predicted mol wt 30kDa including tags
• 정제법: immobilized metal affinity chromatography (IMAC)
• 포장: pkg of 1nmol × 5 vials
• 저장 조건: avoid repeated freeze/thaw cycles
• 면역원 서열: SKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVIHTL
• 펩타이드 도해서 수납 번호: PAp01123803; PAp01659985; PAp01667242
• UniProt 수납 번호: O60486
• 배송 상태: wet ice
• 저장 온도: −20°C
• 유전자 정보: human ... PLXC1(10154)

설명

일반 설명

Lys, Arg ¹³C and ¹⁵N metabolically labeled recombinant human protein fragment

애플리케이션

Internal standard in MS-based quantitative proteomics

물리적 형태

Heavy proteins are provided in solution of 1M Urea PBS, pH 7.4

제조 메모

The protein solution should be gently mixed before use. Optimal concentrations and conditions for each application should be determined by the user.

분석 메모

Isotopic Label Incorporation

The SILuPrEST standards are produced using metabolic labeling with heavy isotope labeled (15N, 13C) Lysine and Arginine residues, with greater than 99% isotopic label incorporation.

A purification and quantification tag (QTag) consisting of a hexahistidine (His6) sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G.

All SILuPrESTs contain an N-terminal His6ABP fusion tag, used for accurate determination of concentration. The fusion tag sequence is:

GSSHHHHHHSSGLVPRGSHMASLAEAKVLANRELDKYGVSDYHKNLINNAKTVEGVKDLQAQVVESAKKARISEATDGLSDFLKSQTPAEDTVKSIELAEAKVLANRELDKYGVSDYYKNLINNAKTVEGVKALIDEILAALPGTFAHYMDPNSSSVDKLAAA.

The specific human protein sequence begins directly after ′VDKLAAA′.

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), [email protected]

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 12 - Non Combustible Liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable