MSQC6

SILu^™MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody

recombinant, expressed in CHO cells

• 동의어(들): SILu^™MAB Stable-Isotope Labeled Universal Monoclonal Antibody Standard human, IgG1 kappa, K1 Stable-Isotope Labeled Universal Monoclonal Antibody
• UNSPSC 코드: 12352200
• NACRES: NA.12

속성

• 재조합: expressed in CHO cells
• Quality Level: 200
• 항체 생산 유형: primary antibodies
• 분석: ≥90% (SDS-PAGE)
• 포장: vial of 100 μg (± 10% Lot-specific vial content given on certificate of analysis)
• 배송 상태: wet ice
• 저장 온도: −20°C

설명

애플리케이션

SILu^™ MAB K1 Stable-Isotope Labeled Universal Monoclonal Antibody has been used to spike peptide samples to assess preparation reproducibility.

특징 및 장점

Universal Peptide Sequence Location
FNWYVDGVEVHNAK Heavy Chain (IgG1)
VVSVLTVLHQDWLNGK Heavy Chain (IgG1, IgG3, IgG4)
GFYPSDIAVEWESNGQPENNYK Heavy Chain (IgG1, IgG4)
SGTASVVCLLNNFYPR Light Chain (kappa)
VDNALQSGNSQESVTEQDSK Light Chain (kappa)
DSTYSLSSTLTLSK Light Chain (kappa)

SILu^™Mab has been validated as an internal standard for quantitation of relevant biotherapeutics in a complex biological matrix by MRM-based LC-MS/MS.

• SILu^™Mab yielded reproducible, linear curves from 0.1 μg/mL to 1000 μg/mL without enrichment or depletion.
• Good agreement was observed between multiple peptides derived from the same target.
• Label incorporation was determined to be >98% by mass spectrometry.
• Sequence coverage was confirmed by peptide mapping.

물리적 형태

Supplied as a lyophilized powder containing phosphate buffered saline

제조 메모

Produced utilizing enriched media containing stable isotope labeled amino acids are ¹³C<SUB>6</SUB>, ¹⁵N<SUB>4</SUB>-labeled Arginine and ¹³C<SUB>6</SUB>, ¹⁵N<SUB>2</SUB>-labeled Lysine.

SILu^™Mab design is optimized to be used as an internal standard for quantitation of monoclonal antibodies as well as Fc-fusion therapeutics. Because of overlap with the common sequences in the Fc region with candidate antibodies, SILu^™Mab provides univer­sal utility, thus eliminating the need for production of candidate-specific internal standards.

재구성

SILuMab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product. Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.
Procedure

• Briefly centrifuge the vial at ~10,000 x g to collect the product at the bottom of the vial.
• Add 500 μL of purified water containing 0.1% formic acid to the vial.
• Mix the contents by gently inverting the vial a minimum of 5 times.
• Allow the vial to stand at room temperature for a minimum of 15 minutes and repeat mixing by inversion.

분석 메모

SILuMAb K1 Heavy Chain

EVQLVESGGGLVQPGGSLRLSCVASGFTLNNYDMHWVRQGIGKGLEWVSKIGTAGDRYYAGSVKGRFTISRENAKDSLYLQMNSLRVGDAAVYYCARGAGRWAPLGAFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMAb K1 Light Chain

QSALTQPRSVSGSPGQSVTISCTGTSSDIGGYNFVSWYQQHPGKAPKLMIYDATKRPSGVPDRFSGSKSGNTASLTISGLQAEDEADYYCCSYAGDYTPGVVFGGGTKLTVLTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Target overlap areas are underlined
Package size based on protein content determined by A₂₈₀ using an extinction coefficient (E^0.1%) of 1.4

Quantitative
MRM settings provided (xls)

법적 정보

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.

SILu is a trademark of Sigma-Aldrich Co. LLC

안전성 정보

• Storage Class Code: 13 - Non Combustible Solids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable