콘텐츠로 건너뛰기
Merck
모든 사진(4)

문서

HPA045727

Sigma-Aldrich

Anti-SDHD antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-PGL, Anti-PGL1, Anti-cybS, Anti-Succinate Dehydrogenase Complex, Subunit D, Integral Membrane Protein

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:20- 1:50

면역원 서열

RTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSKAASLHW

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SDHD(6392)

일반 설명

Succinate dehydrogenase complex subunit D (SDHD) gene encodes for a protein SDHD. It is a small sub unit of the cytochrome b, that is involved in the complex II of mitochondrial respiration. It is located at 11q23.1 on the human chromosome.

면역원

Succinate dehydrogenase complex subunit D recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SDHD antibody produced in rabbit has been used in immunohistochemistry.

생화학적/생리학적 작용

Mutation in this gene leads to paraganglioma and phaeochromocytoma.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST84465

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

In vivo detection of succinate by magnetic resonance spectroscopy as a hallmark of SDHx mutations in paraganglioma
Lussey L C, et al.
Clinical Cancer Research, 22(5), 1120-1129 (2016)
Risk assessment of maternally inherited SDHD paraganglioma and phaeochromocytoma
Burnichon N, et al.
Journal of medical Genetics, 54(2), 125-133 (2017)
Analysis of the SDHD gene, the susceptibility gene for familial paraganglioma syndrome (PGL1), in pheochromocytomas
Aguiar R C T, et al.
The Journal of Clinical Endocrinology and Metabolism, 86(6), 2890-2894 (2001)
Mélanie Menara et al.
The Journal of clinical endocrinology and metabolism, 100(2), E287-E291 (2014-11-19)
Pheochromocytomas (PCC) and paragangliomas (PGL) may be caused by a germline mutation in 12 different predisposing genes. We previously reported that immunohistochemistry is a useful approach to detect patients harboring SDHx mutations. SDHA immunostaining is negative in SDHA-mutated tumors only
Charlotte Lussey-Lepoutre et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 22(5), 1120-1129 (2015-10-23)
Germline mutations in genes encoding mitochondrial succinate dehydrogenase (SDH) are found in patients with paragangliomas, pheochromocytomas, gastrointestinal stromal tumors, and renal cancers. SDH inactivation leads to a massive accumulation of succinate, acting as an oncometabolite and which levels, assessed on

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.