콘텐츠로 건너뛰기
Merck
모든 사진(6)

문서

HPA036119

Sigma-Aldrich

Anti-CHMP7 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-CHMP family, member 7, Anti-MGC29816

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

mouse, human, rat

기술

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

면역원 서열

LALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTL

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... CHMP7(91782)

일반 설명

The gene CHMP7 (charged multivesicular body protein 7) is mapped to human chromosome 8p. The encoded protein has an SNF7 (sucrose non-fermenting protein 7) domain and a distantly SNF7-related domain. It belongs to the CHMP family of proteins.

면역원

CHMP family, member 7 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-FGF19 antibody produced in rabbit has been used for western blotting.

생화학적/생리학적 작용

CHMP7 (charged multivesicular body protein 7) is a CHMP4-associated ESCRT-III (endosomal sorting complex required for transport)-related protein. It might have a role in endosomal sorting. During nuclear envelope formation, it participates in the recruitment of ESCRT-III to the envelope. The amino terminal tandem winged helix (WH)-domains allow CHMP7 association with endoplasmic reticulum and thereby help in ESCRT-III recruitment to nuclear envelope. Mutations in the CHMP7 gene prevent proper post-mitotic nucleo-cytoplasmic compartmentalization.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST76258.

물리적 형태

Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Spastin and ESCRT-III coordinate mitotic spindle disassembly and nuclear envelope sealing.
Vietri M
Nature, 522(7555), 231-235 (2015)
CHMP7, a novel ESCRT-III-related protein, associates with CHMP4b and functions in the endosomal sorting pathway.
Horii M
The Biochemical Journal, 400(1), 23-32 (2006)
LEM2 recruits CHMP7 for ESCRT-mediated nuclear envelope closure in fission yeast and human cells.
Gu M
Proceedings of the National Academy of Sciences of the USA, 114(11), E2166-E2175 (2017)
Joshua J Elacqua et al.
PloS one, 13(4), e0195664-e0195664 (2018-04-13)
Recent in vitro and in vivo studies have highlighted the importance of the cell nucleus in governing migration through confined environments. Microfluidic devices that mimic the narrow interstitial spaces of tissues have emerged as important tools to study cellular dynamics
Protein phosphatase and TRAIL receptor genes as new candidate tumor genes on chromosome 8p in prostate cancer.
Hornstein M
Cancer, Genomics, and Proteomics, 5(2), 123-136 (2008)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.