콘텐츠로 건너뛰기
Merck
모든 사진(4)

문서

HPA023882

Sigma-Aldrich

Anti-FAT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Cadherin-related tumor suppressor homolog, Anti-Protein fat homolog, Anti-Protocadherin Fat 1

로그인조직 및 계약 가격 보기
모든 사진(4)

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
HPA023882
NACRES:
NA.43

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

기술

immunohistochemistry: 1:50- 1:200

면역원 서열

NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP

UniProt 수납 번호

Q14517

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... FAT1(2195)

일반 설명

FAT atypical cadherin 1 (FAT1) protein is encoded by a gene mapped to human chromosome 4q34-35. The protein has ubiquitous expression in mammalian tissues, especially higher in kidney glomerular epithelial cells. FAT1 is localized to the leading edge of lamellipodia, filopodia, and microspike tips of cells. The protein is found to be abnormally expressed in pediatric patients with acute leukemia.
The encoded protein is characterized with cytoplasmic domain that is involved in assembly of components necessary to promote ectopic actin polymerization.

면역원

Protocadherin Fat 1 Precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-FAT1 antibody produced in rabbit has been used for western blotting. FAT1 antibody produced in rabbit has been used in immunofluorescence, tissue microarrays (TMAs) and immunohistochemistry (IHC).
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

생화학적/생리학적 작용

FAT atypical cadherin 1 (FAT1) acts as a proximal element of cell migration signaling pathways.FAT1 interacts with Ena/Vasodilator-stimulated phosphoprotein (VASP) at the leading edges of lamellipodia, filopodia, and microspike tips and helps in normal actin dynamics and cell polarization. FAT1, with or without β-catenin, might function as a novel biomarker for breast cancer. Mutation of FAT1 gene leads to T-cell acute lymphoblastic leukemia (T-ALL) in adults. In humans, FAT1 might act both as an oncogene and a tumor suppressor. The protein modulates oncogenic pathways in glioma cell lines. FAT1 also act as a co-activator of hypoxia and growth receptor signaling to critical tumorigenic pathways in hepatocellular carcinoma (HCC).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST85143

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our 제품 선택기 도구.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Podocyte proteins in congenital and minimal change nephrotic syndrome.
Suvanto M, et al.
Clinical and Experimental Nephrology, 19(3), 481-488 (2015)
Loss of FAT1 during the progression from DCIS to IDC and predict poor clinical outcome in breast cancer.
26721716
Wang L
Experimental and Molecular Pathology, 100(1), 177-183 (2016)
FAT1 expression and mutations in adult acute lymphoblastic leukemia.
Neumann M
Blood Cancer Journal, 4 (2014)
Michael P Weekes et al.
Cell, 157(6), 1460-1472 (2014-06-07)
A systematic quantitative analysis of temporal changes in host and viral proteins throughout the course of a productive infection could provide dynamic insights into virus-host interaction. We developed a proteomic technique called "quantitative temporal viromics" (QTV), which employs multiplexed tandem-mass-tag-based
De-Chen Lin et al.
Nature genetics, 46(8), 866-871 (2014-06-24)
Nasopharyngeal carcinoma (NPC) has extremely skewed ethnic and geographic distributions, is poorly understood at the genetic level and is in need of effective therapeutic approaches. Here we determined the mutational landscape of 128 cases with NPC using whole-exome and targeted
모든 관련된 서류 보기

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.