콘텐츠로 건너뛰기
Merck
모든 사진(2)

Key Documents

HPA019953

Sigma-Aldrich

Anti-PPM1L antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

동의어(들):

Anti-PP2C-epsilon, Anti-Protein phosphatase 1-like, Anti-Protein phosphatase 1L, Anti-Protein phosphatase 2C isoform epsilon

로그인조직 및 계약 가격 보기
모든 사진(2)

About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
HPA019953
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

100

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

형태

buffered aqueous glycerol solution

종 반응성

human

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

면역원 서열

DLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPDNITVMVVKFRNSSK

UniProt 수납 번호

Q5SGD2

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PPM1L(151742)

일반 설명

PPM1L (Protein phosphatase, Mg2+/Mn2+ dependent 1L) is a novel serine-threonine phosphatase belonging to PP2C family.

면역원

Protein phosphatase 1L recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PPM1L antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

PPM1L (Protein phosphatase, Mg2+/Mn2+ dependent 1L) is involved in the H2O2-induced regulation of ASK1 signaling. It suppresses gene expression of SAPK (stress-activated protein kinase) by associating with and dephosphorylating MAP3K7/TAK1 and MAP3K5. It is also associated with the regulation of the TGF-β and BMP (Bone Morphogenetic Protein) signaling pathways.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73644

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Zhaoyu Li et al.
Cell, 148(1-2), 72-83 (2012-01-24)
Hepatocellular carcinoma (HCC) is sexually dimorphic in both rodents and humans, with significantly higher incidence in males, an effect that is dependent on sex hormones. The molecular mechanisms by which estrogens prevent and androgens promote liver cancer remain unclear. Here
Jun-ichi Saito et al.
The Biochemical journal, 405(3), 591-596 (2007-04-26)
ASK1 (apoptosis signal-regulating kinase 1), a MKKK (mitogen-activated protein kinase kinase kinase), is activated in response to cytotoxic stresses, such as H2O2 and TNFalpha (tumour necrosis factor alpha). ASK1 induction initiates a signalling cascade leading to apoptosis. After exposure of
L F Thean et al.
Genes, chromosomes & cancer, 49(2), 99-106 (2009-10-23)
Familial adenomatous polyposis (FAP) is an autosomal dominantly inherited form of colorectal cancer (CRC) caused by mutation in the adenomatous polyposis coli (APC) gene. However, APC mutations are not detected in 10-50% of FAP patients. We searched for a new

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.