HPA015313

Anti-NDRG4 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-Brain development-related molecule 1, Anti-Protein NDRG4, Anti-SMAP-8, Anti-Vascular smooth muscle cell-associated protein 8
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA015313
• NACRES: NA.43

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 향상된 검증: orthogonal RNAseq; recombinant expression; Learn more about Antibody Enhanced Validation
• 기술: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• 면역원 서열: RQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLP
• UniProt 수납 번호: Q9ULP0
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... NDRG4(65009)

설명

일반 설명

NDRG4 (N-myc downstream regulated gene 4) is a member of the four protein family called NDRG. This protein, along with NDRG2 makes up a subfamily. This gene is localized to human chromosome 16q21-q22.3, is composed of seventeen exons, and spans 26kb. Alternative splicing gives rise to three isoforms called, NDRG4-B, NDRG4-B^var, and NDRG4-H. Its expression is restricted to brain and heart.

면역원

Protein NDRG4 recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-NDRG4 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

NDRG4 (N-myc downstream regulated gene 4) is believed to act as a tumor suppressor gene, as it is inactivated in multiple cancer types. Studies suggest that this gene is involved in the survival of cell, and invasiveness of tumor cells. Homozygous variant in this gene might be the cause of infantile myofibromatosis (IM), which is characterized by benign tumor development in bone, viscera, skin and muscle. This gene is up-regulated in aggressive meningioma, and is involved in controlling cell proliferation, metastasis and angiogenesis in the same. It is methylated and silenced in colorectal cancer (CRC), and might have potential as a marker to determine CRC in sample stools. It is essential for cell growth and survival in glioblastoma and astrocytes.

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72717

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)