HPA014791

Anti-CLPTM1L antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• 동의어(들): Anti-CLPTM1-like protein, Anti-CRR9p, Anti-Cisplatin resistance-related protein 9, Anti-Cleft lip and palate transmembrane protein 1-like protein
• UNSPSC 코드: 12352203
• 인간 단백질 도해서 번호: HPA014791
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 제품 라인: Prestige Antibodies^® Powered by Atlas Antibodies
• 형태: buffered aqueous glycerol solution
• 종 반응성: human
• 기술: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:500-1:1000
• 면역원 서열: LNVEDFDVESKFERTVNVSVPKKTRNNGTLYAYIFLHHAGVLPWHDGKQVHLVSPLTTYMVPKPEEINLLTGESDTQQIEAEKKPTSALDEPVSHWRPRLALNVMADNFVFDGSSLPADVHRYMKMIQLGKTVHYL
• UniProt 수납 번호: Q96KA5
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... CLPTM1L(81037)

설명

일반 설명

CLPTM1L (cleft lip and palate trans-membrane 1-like) was originally discovered as a gene conferring resistance to cisplatin in ovarian cancer cells. Thus, it is also called cisplatin resistance-related protein 9 (CRR9p). This gene is localized to human chromosome 5p15.33. It is expressed in multiple types of tumors, and is up-regulated in cisplatin-resistant tumor cell lines.

면역원

Cleft lip and palate transmembrane protein 1-like protein recombinant protein epitope signature tag (PrEST)

애플리케이션

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

CLPTM1L (cleft lip and palate trans-membrane 1-like) is mainly involved in maintaining genomic stability and integrity, by controlling the activity of telomerases. This protein might be involved in apoptosis. It is up-regulated in lung cancer, and regulates Bcl-xL, and inhibits genotoxic stress-mediated apoptosis in lung tumor cells. Therefore, it facilitates lung tumorigenesis. It facilitates growth in pancreatic cells, and is up-regulated in pancreatic cancer cells, where it promotes growth and aneuploidy. Genome wide association studies (GWAS) show that polymorphisms in this gene are also linked to susceptibility to familial and bilateral testicular germ cell tumours (TGCTs).

특징 및 장점

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST73014

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• 개인 보호 장비: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)